PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07405g02009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 354aa    MW: 38372.4 Da    PI: 9.4281
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07405g02009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.62.4e-3772130462
                    zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               + ++cprC+stntkfCy+nnyslsqPr+fCk+CrryWt+GGalr vPvGgg+r+nk+s+
  Niben101Scf07405g02009.1  72 AVQECPRCESTNTKFCYFNNYSLSQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRSN 130
                               6789****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3454128IPR003851Zinc finger, Dof-type
PfamPF027014.3E-3273128IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.94774128IPR003851Zinc finger, Dof-type
PROSITE patternPS01361076112IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 354 aa     Download sequence    Send to blast
MVFSSISAYL DPANWQQQAG HSIQNPQFQS VQPQRTLAAP PLVQTHVGGG GTIRPGSMAD  60
RARLANIPMA EAVQECPRCE STNTKFCYFN NYSLSQPRHF CKTCRRYWTR GGALRSVPVG  120
GGCRRNKRSN NSTKATNNNN NTPKSPASST STGGCRQIAT NSGSTSNNNN SFSSPSSAAS  180
LLGLMTPQIH HPLRFMSPLG QLTDHHFTPN DNNITMNYSA ISSSSAPVAG TNENMSFQLG  240
MGGNLEQWRL QQQVANQFPN FYGGLDSSSA SGLYPFHPAY YTSNDAGGVT VTSTQIRPKI  300
TNPMLTQLAL MKMEDNHEHS SLSRQFVGNE NWSNGNAWNE LSASFSSSST SNAL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780702.10.0PREDICTED: dof zinc finger protein DOF2.4-like
RefseqXP_016473568.10.0PREDICTED: dof zinc finger protein DOF2.4-like
TrEMBLK4D4761e-133K4D476_SOLLC; Uncharacterized protein
STRINGSolyc10g086440.1.11e-132(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19172463
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37590.13e-48DNA binding with one finger 2.4